Monoclonal antibody to Streptavidin-binding protein

A monoclonal antibody to the streptavidin binding epitope tag that can be fused to any protein from any species for use in affinity purification of proteins.
Technology No.

Researchers at the University of Edinburgh have generated a monoclonal antibody to the streptavidin binding epitope tag widely used in affinity purification of proteins.

The streptavidin-binding protein monoclonal antibody has been raised against the streptavidin binding peptide tag (peptide sequence MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) conjugated to KLH.

It has been tested in immunoblotting analysis as well as immuno-fluorescence microscopy and demonstrated to work very well. The antibody was raised in mice and is an IgG1k isotype.

Hybridoma cells expressing a monoclonal antibody against the Streptavadin Binding Protein tag are available to license from the University of Edinburgh to manufacture and sell antibodies for research purposes.

This license is royalty bearing - details are disclosed in the non-exclusive licence agreement.

 

  • expand_more library_books References (1)
    1. Hudson (2008), Molecular and Genetic Analysis of Condensin Function in Vertebrate Cells, Molecular Biology of the Cell, Vol. 19, Issue 7, pp 3070-79
  • expand_more cloud_download Supporting documents (1)
    Product brochure
    Monoclonal antibody to Streptavidin-binding protein.pdf
    Additional files may be available once you've completed the transaction for this product. If you've already done so, please log into your account and visit My account / Downloads section to view them.
Commercial Licence Agreement for SBP-tag research reagents
Commercial Licence with signing fee

Term: 36 months

Price per unit:
From £1,000.00 excl. VAT