My basket (no items)
Sign-in
  • DESCRIPTION
  • FILES (3)
  • REFERENCES (1)
  • SUPPORT

Researchers at the University of Edinburgh have generated a monoclonal antibody to the streptavidin binding epitope tag widely used in affinity purification of proteins.

The streptavidin-binding protein monoclonal antibody has been raised against the streptavidin binding peptide tag (peptide sequence MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) conjugated to KLH.

It has been tested in immunoblotting analysis as well as immuno-fluorescence microscopy and demonstrated to work very well. The antibody was raised in mice and is an IgG1k isotype.

Hybridoma cells expressing a monoclonal antibody against the Streptavadin Binding Protein tag are available to license from the University of Edinburgh to manufacture and sell antibodies for research purposes.

This license is royalty bearing - details are disclosed in the non-exclusive licence agreement.

 

Monoclonal antibody to Streptavidin-binding protein

OPTIONS
Please check carefully that the terms you select correspond to your intended use of the product.

Commercial Licence Agreement for SBP-tag research reagents 5.00

Commercial Licence with signing fee

View Terms

Further details
Term: 36 months
Seats: n/a

Price excl. VAT: £1000.00